4.75 Rating by CuteStat

attractionmarketing.com is 2 decades 4 years old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, attractionmarketing.com is SAFE to browse.

PageSpeed Score
90
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 211,000
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

45.33.23.182

Hosted Country:

United States of America US

Location Latitude:

32.7787

Location Longitude:

-96.8217
Attraction Marketing – Attraction Marketing

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 45.33.23.182)

Elite Marketing Pro | Welcome

- seanlynnwyman.elitemarketingpro.com

Elite Marketing Pro is a global community of over 50,000 active small business entrepreneurs, providing targeted education, training, and mentoring programs

92,015 $ 90,000.00

Elite Marketing Pro | Welcome

- miguelisaac.elitemarketingpro.com

Elite Marketing Pro is a global community of over 50,000 active small business entrepreneurs, providing targeted education, training, and mentoring programs

96,429 $ 86,400.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Thu, 26 Dec 2019 02:17:51 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Vary: Accept-Encoding, Cookie
Server: AUTOM8N-nginx
Expires: Thu, 26 Dec 2019 02:22:51 GMT
Cache-Control: max-age=300
Cache-Control: must-revalidate
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
X-Cache-Status: BYPASS
Pragma: no-cache
Content-Encoding: gzip

Domain Information

Domain Registrar: acens Technologies, S.L.U.
Registration Date: Jul 16, 1999, 4:54 AM 2 decades 4 years 9 months ago
Expiration Date: Jul 16, 2020, 4:54 AM 3 years 9 months 1 week ago
Domain Status:
clienttransferprohibited
clientupdateprohibited
clientrenewprohibited
clientdeleteprohibited

Domain Nameserver Information

Host IP Address Country
elsa.ns.cloudflare.com 108.162.192.111 United States of America United States of America
greg.ns.cloudflare.com 108.162.193.115 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
attractionmarketing.com A 299 IP: 45.33.23.182
attractionmarketing.com NS 86400 Target: elsa.ns.cloudflare.com
attractionmarketing.com NS 86400 Target: greg.ns.cloudflare.com
attractionmarketing.com SOA 3600 MNAME: elsa.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2031151540
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
attractionmarketing.com MX 300 Priority: 10
Target: alt4.aspmx.l.google.com
attractionmarketing.com MX 300 Priority: 1
Target: aspmx.l.google.com
attractionmarketing.com MX 300 Priority: 5
Target: alt1.aspmx.l.google.com
attractionmarketing.com MX 300 Priority: 5
Target: alt2.aspmx.l.google.com
attractionmarketing.com MX 300 Priority: 10
Target: alt3.aspmx.l.google.com
attractionmarketing.com TXT 300 TXT: google-site-verification=UH4Nk0DXkdpicW7
BbbBxitxeJUwfMAoNoCOGTzZ5lI4

Full WHOIS Lookup

Domain Name: attractionmarketing.com
Registry Domain ID: 8042921_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-07-16T14:43:20Z
Creation Date: 1999-07-15T23:09:15Z
Registrar Registration Expiration Date: 2020-07-15T23:09:15Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization:
Registrant State/Province: FL
Registrant Country: US
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=attractionmarketing.com
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=attractionmarketing.com
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=attractionmarketing.com
Name Server: ELSA.NS.CLOUDFLARE.COM
Name Server: GREG.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-26T02:00:00Z <<<

For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

Notes:

IMPORTANT: Port43 will provide the ICANN-required minimum data set per
ICANN Temporary Specification, adopted 17 May 2018.
Visit https://whois.godaddy.com to look up contact data for domains
not covered by GDPR policy.

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.